An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: WCKJ01000120.1
FASTA Graphics
LOCUS WCKJ01000120 1163 bp DNA linear BCT 24-DEC-2019 DEFINITION Glaesserella parasuis strain H313 Scaffold120, whole genome shotgun sequence. ACCESSION WCKJ01000120 WCKJ01000000 VERSION WCKJ01000120.1 DBLINK BioProject: PRJNA576038 BioSample: SAMN12920959 KEYWORDS WGS. SOURCE Glaesserella parasuis (Haemophilus parasuis) ORGANISM Glaesserella parasuis Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Glaesserella. REFERENCE 1 (bases 1 to 1163) AUTHORS Li,C., Yan,H., Wan,X. and Wang,G. TITLE WGS characterization of a Glaesserella parasuis isolate JOURNAL Unpublished REFERENCE 2 (bases 1 to 1163) AUTHORS Li,C., Yan,H., Wan,X. and Wang,G. TITLE Direct Submission JOURNAL Submitted (06-OCT-2019) School of Food Science and Engineering, South China University of Technology, Wushan Road, Guangzhou, Guangdong 510640, China COMMENT The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SOAPdenovo v. 1.05 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 99.79x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Date :: 10/08/2019 13:28:35 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 4.9 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total) :: 2,413 CDSs (total) :: 2,356 Genes (coding) :: 2,189 CDSs (with protein) :: 2,189 Genes (RNA) :: 57 rRNAs :: 1, 2, 2 (5S, 16S, 23S) partial rRNAs :: 1, 2, 2 (5S, 16S, 23S) tRNAs :: 48 ncRNAs :: 4 Pseudo Genes (total) :: 167 CDSs (without protein) :: 167 Pseudo Genes (ambiguous residues) :: 10 of 167 Pseudo Genes (frameshifted) :: 76 of 167 Pseudo Genes (incomplete) :: 85 of 167 Pseudo Genes (internal stop) :: 28 of 167 Pseudo Genes (multiple problems) :: 30 of 167 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1163 /organism="Glaesserella parasuis" /mol_type="genomic DNA" /submitter_seqid="Scaffold120" /strain="H313" /host="swine" /db_xref="taxon:738" /geo_loc_name="China" /collection_date="2016" gene <1..>434 /locus_tag="F9889_11700" CDS <1..>434 /locus_tag="F9889_11700" /inference="COORDINATES: protein motif:HMM:PF00509.16" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="hemagglutinin" /protein_id="MWQ00827.1" /translation="GNPSCDLMLEGREWSYIVERPSAVNGLCYPGHVENLEELRSLFS SARSYQRVQIFPDTIWNVSYDGTSTACSGSFYRSMRWLTRKNGDYPIQDAQYTNNQGK NILFMWGINHPPADTTQRNLYTRTDTTTSVATEEVNRIFKPL" assembly_gap 435..454 /estimated_length=20 /gap_type="within scaffold" /linkage_evidence="paired-ends" gene <455..>1163 /locus_tag="F9889_11705" CDS <455..>1163 /locus_tag="F9889_11705" /inference="COORDINATES: protein motif:HMM:PF00509.16" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=3 /transl_table=11 /product="hemagglutinin" /protein_id="MWQ00828.1" /translation="RPLVNGLMGRIDYYWSVLKPGQTLRIKSDGNLIAPWYGHILSGE SHGRILKTDLKRGSCTVQCQTEKGGLNTTLPFQNVSKYAFGNCSKYIGMKSLKLAVGL RNVPSRSSRGLFGAIAGFIEGGWSGLVAGWYGFQHSNDQGVGMAADRDSTQKAIDKIT SKVNNIVDKMNKQYEIIDHEFSEVETRLNMINNKIDDQIQDIWAYNAELLVLLENQKT LDEHDANVNNLYNKVKRA" ORIGIN 1 ggcaatcctt cttgtgatct aatgctggaa ggaagagaat ggtcctacat cgtcgagaga 61 ccatcagctg ttaacggatt gtgttacccc gggcacgtag aaaatctaga agagctgagg 121 tcacttttta gttctgctag gtcttatcaa agagtccaga ttttcccaga cacaatctgg 181 aatgtgtctt atgatgggac aagcactgca tgctcaggtt cattctacag aagcatgaga 241 tggctgacta gaaagaacgg cgattacccc attcaagacg cccaatacac aaataatcaa 301 gggaagaaca ttcttttcat gtggggcata aatcacccac ccgccgatac aacgcagaga 361 aatctgtaca cgagaaccga cacaacaacg agtgtggcaa cagaagaagt aaataggatc 421 ttcaaaccat tgatnnnnnn nnnnnnnnnn nnnncaaggc ctcttgtcaa cggtttgatg 481 ggaagaattg attattattg gtcggtattg aaaccgggtc aaacactgcg aataaaatct 541 gatgggaatc taatagctcc atggtatgga cacattcttt caggagagag ccacggaaga 601 attctgaaga ctgacttaaa aaggggtagc tgcacagtgc aatgtcagac agagaaagga 661 ggcttaaaca caacattgcc attccaaaat gtaagtaagt atgcatttgg aaactgctca 721 aaatacattg gcatgaagag tctcaaactt gcagttggtc tgaggaatgt gccttctaga 781 tctagtagag gactattcgg ggccatagca gggtttatag agggaggttg gtcaggacta 841 gttgctggtt ggtatgggtt ccagcattca aatgaccaag gggttggtat ggcagcagat 901 agagactcaa cccaaaaggc aattgataaa ataacatcca aagtgaataa tatagtcgac 961 aaaatgaaca agcaatatga aatcattgat catgaattca gtgaagtaga aactagactt 1021 aacatgatca ataataagat tgatgatcaa atccaggata tatgggcata taatgcagaa 1081 ttgctagttt tgcttgaaaa ccagaaaaca ctcgatgagc atgacgcaaa tgtaaacaat 1141 ctatataata aagtaaagag ggc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on